PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013629566.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 295aa    MW: 31546.8 Da    PI: 6.924
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013629566.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.49.1e-101156346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +W+ e+d  + +a + +  +    W++Ia+ ++ g++ +q+k+++  
   XP_013629566.1 11 AWSREDDIAFERALASHTDEseeKWEKIAADVP-GKSVEQIKEHYEV 56
                     7*****************99*************.**********965 PP

2Myb_DNA-binding422.1e-13119163347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_013629566.1 119 AWTEDEHRLFLLGLDKYGKGDWRSISRNFVVTRTPTQVASHAQKY 163
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512938.047762IPR017884SANT domain
SMARTSM007176.0E-9860IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-51057IPR009057Homeodomain-like
PfamPF002491.7E-81155IPR001005SANT/Myb domain
CDDcd001677.72E-91158No hitNo description
SuperFamilySSF466891.22E-91265IPR009057Homeodomain-like
PROSITE profilePS5129417.173112168IPR017930Myb domain
SuperFamilySSF466891.27E-16114169IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-17116166IPR006447Myb domain, plants
SMARTSM007173.2E-10116166IPR001005SANT/Myb domain
CDDcd001678.38E-10119164No hitNo description
Gene3DG3DSA:1.10.10.601.4E-10119162IPR009057Homeodomain-like
PfamPF002492.7E-11119163IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MTVEEVSDGS AWSREDDIAF ERALASHTDE SEEKWEKIAA DVPGKSVEQI KEHYEVLVED  60
VGRIESGCVP LPDYGSPEGS SGHGGDHGGS RKKGGNSHAG ESNQGSKAKS EQERRKGIAW  120
TEDEHRLFLL GLDKYGKGDW RSISRNFVVT RTPTQVASHA QKYFIRLNSM NKDRRRSSIH  180
DITSVGDADV STPQGPITGQ NNNNNNNTGS TAVTGGGNKS AKQAASQPPP LPSMYGTPTI  240
GQPVTGPLVS AVGTPVNLPP PPHLAFGVHT APVPGAPVNM GQMPYTMPRT PTAHR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-15980879RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013629566.10.0PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H76e-60DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0D3B0B20.0A0A0D3B0B2_BRAOL; Uncharacterized protein
STRINGAT5G08520.11e-175(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM35562861
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-155MYB family protein